PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g029520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family G2-like
Protein Properties Length: 358aa    MW: 40135.7 Da    PI: 9.0536
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g029520.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32220275156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs++AtPk+i++lmkv+gLt+++vkSHLQkYRl+
  Csa03g029520.1 220 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLH 275
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-29217278IPR009057Homeodomain-like
PROSITE profilePS5129414.163217277IPR017930Myb domain
SuperFamilySSF466893.58E-18218278IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-27220275IPR006447Myb domain, plants
PfamPF002492.6E-7222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MDVYAHKMKR CHEYVEALEE EHKKILVFQR ELPLCLELVT QAIESCRKEL SGSSSMSEHV  60
RSQSECSERT TSECGGGGAA VFEEFIPIKW SSPSSSDHEN DRDGADEKKI KMNNENNGDK  120
KKSDWLRSVQ LWNQSPDPQP KEDDHQVINK QKAAAVIEVK RNNAGAFQPF QKDKPKANER  180
SPQPLKTITP TPTTTSSSTA ETVGGKSEFE QLKQSQSSRK QRRCWSPELH RRFLHALQQL  240
GGSHVATPKQ IRDLMKVDGL TNDEVKSHLQ KYRLHTRRPA TPSSTNGGEN QQQRQFMVVE  300
GIWVPSSHDR ATNTRVYAPI ATQPPPQSSP SGERSSHRCK SPATSSSTHT QHLLPLS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010499096.10.0PREDICTED: probable transcription factor GLK2
TrEMBLR0GQJ31e-178R0GQJ3_9BRAS; Uncharacterized protein
STRINGAT1G25550.11e-165(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-158G2-like family protein